Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against SLC12A4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DPSHAPDNFRE, from the internal region of the protein sequence according to NP_005063.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLC12A4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC12A4 Antibody: synthetic peptide directed towards the N terminal of human SLC12A4. Synthetic peptide located within the following region: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL |
Anti-SLC12A4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 866-1085 amino acids of human solute carrier family 12 (potassium/chloride transporters), member 4 |
Anti-SLC12A4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 866-1085 amino acids of human solute carrier family 12 (potassium/chloride transporters), member 4 |
Active filters
Target Symbol
- SLC12A4
Families
- Transmembrane