Antibodies

cDNA Clones (24)
Antibodies (2)
Jump to Filters
View as table Download
SLC35B2 (NM_001286519) Human Tagged ORF Clone
RC237299

USD 420.00

2 Weeks

SLC35B2 (myc-DDK-tagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SLC35B2 (NM_001286520) Human Tagged ORF Clone
RC237300

USD 420.00

2 Weeks

SLC35B2 (myc-DDK-tagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 9

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SLC35B2 (NM_001286517) Human Tagged ORF Clone
RC237467

USD 420.00

2 Weeks

SLC35B2 (myc-DDK-tagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SLC35B2 (NM_001286513) Human Tagged ORF Clone
RC237568

USD 420.00

2 Weeks

SLC35B2 (myc-DDK-tagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SLC35B2 (NM_001286511) Human Tagged ORF Clone
RC237873

USD 420.00

2 Weeks

SLC35B2 (myc-DDK-tagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SLC35B2 (NM_001286512) Human Tagged ORF Clone
RC237874

USD 420.00

2 Weeks

SLC35B2 (myc-DDK-tagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SLC35B2 (NM_001286509) Human Tagged ORF Clone
RC238164

USD 420.00

2 Weeks

SLC35B2 (myc-DDK-tagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SLC35B2 (NM_001286510) Human Tagged ORF Clone
RC238165

USD 420.00

2 Weeks

SLC35B2 (myc-DDK-tagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SLC35B2 (C-term) Rabbit Polyclonal Antibody
AP53780PU-N

USD 450.00

2 Weeks

SLC35B2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 400-429 amino acids from the C-terminal region of Human SLC35B2 (NP_835361.1)
SLC35B2 Rabbit Polyclonal Antibody
TA331358

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC35B2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC35B2 antibody is: synthetic peptide directed towards the C-terminal region of Human SLC35B2. Synthetic peptide located within the following region: CLLYGHTVTVVGGLGVAVVFAALLLRVYARGRLKQRGKKAVPVESPVQKV
SLC35B2 (NM_001286519) Human Tagged ORF Clone
RG237299

USD 460.00

2 Weeks

SLC35B2 (GFP-tagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 8

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SLC35B2 (NM_001286520) Human Tagged ORF Clone
RG237300

USD 460.00

2 Weeks

SLC35B2 (GFP-tagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 9

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SLC35B2 (NM_001286517) Human Tagged ORF Clone
RG237467

USD 460.00

2 Weeks

SLC35B2 (GFP-tagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SLC35B2 (NM_001286513) Human Tagged ORF Clone
RG237568

USD 460.00

2 Weeks

SLC35B2 (GFP-tagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SLC35B2 (NM_001286511) Human Tagged ORF Clone
RG237873

USD 460.00

2 Weeks

SLC35B2 (GFP-tagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SLC35B2 (NM_001286512) Human Tagged ORF Clone
RG237874

USD 460.00

2 Weeks

SLC35B2 (GFP-tagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SLC35B2 (NM_001286509) Human Tagged ORF Clone
RG238164

USD 460.00

2 Weeks

SLC35B2 (GFP-tagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SLC35B2 (NM_001286510) Human Tagged ORF Clone
RG238165

USD 460.00

2 Weeks

SLC35B2 (GFP-tagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SLC35B2 (NM_001286519) Human Untagged Clone
SC335193

USD 310.00

2 Weeks

SLC35B2 (untagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 8

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SLC35B2 (NM_001286520) Human Untagged Clone
SC335194

USD 310.00

2 Weeks

SLC35B2 (untagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 9

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SLC35B2 (NM_001286517) Human Untagged Clone
SC335361

USD 340.00

2 Weeks

SLC35B2 (untagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 7

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SLC35B2 (NM_001286513) Human Untagged Clone
SC335462

USD 350.00

2 Weeks

SLC35B2 (untagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 6

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SLC35B2 (NM_001286511) Human Untagged Clone
SC335767

USD 390.00

2 Weeks

SLC35B2 (untagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SLC35B2 (NM_001286512) Human Untagged Clone
SC335768

USD 390.00

2 Weeks

SLC35B2 (untagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SLC35B2 (NM_001286509) Human Untagged Clone
SC336058

USD 430.00

2 Weeks

SLC35B2 (untagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SLC35B2 (NM_001286510) Human Untagged Clone
SC336059

USD 430.00

2 Weeks

SLC35B2 (untagged) - Human solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B2 (SLC35B2), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin