Antibodies

Jump to Filters
View as table Download
C2orf18 (SLC35F6) (C-term) Rabbit Polyclonal Antibody
AP50737PU-N

USD 450.00

2 Weeks

C2orf18 (SLC35F6) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 336-366 amino acids from the C-terminal region of human CB018
C2orf18 (SLC35F6) Rabbit Polyclonal Antibody
TA342043

USD 375.00

5 Days

Rabbit Polyclonal Anti-C2orf18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2orf18 antibody: synthetic peptide directed towards the middle region of human C2orf18. Synthetic peptide located within the following region: GLFGFVILSLLLVPMYYIPAGSFSGNPRGTLEDALDAFCQVGQQPLIAVA