Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-SYT11 antibody
| Applications | WB |
| Reactivities | Human, Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SYT11. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SYT11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYT11 antibody: synthetic peptide directed towards the N terminal of human SYT11. Synthetic peptide located within the following region: AGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPS |
Rabbit Polyclonal Anti-SYT11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYT11 antibody: synthetic peptide directed towards the N terminal of human SYT11. Synthetic peptide located within the following region: PPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAE |
Carrier-free (BSA/glycerol-free) SYT11 mouse monoclonal antibody,clone OTI3F3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-SYT11 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 37-200 amino acids of human synaptotagmin XI |
SYT11 mouse monoclonal antibody,clone OTI3F3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SYT11 mouse monoclonal antibody,clone OTI3F3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
SYT11 mouse monoclonal antibody,clone OTI3F3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SYT11 mouse monoclonal antibody,clone OTI3F3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SYT11
Families
- Transmembrane