Rabbit polyclonal anti-CYB5R3 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CYB5R3. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-CYB5R3 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CYB5R3. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CYB5R3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYB5R3 antibody: synthetic peptide directed towards the C terminal of human CYB5R3. Synthetic peptide located within the following region: IRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLD |
Rabbit Polyclonal anti-CYB5R3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYB5R3 |
Rabbit Polyclonal anti-CYB5R3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYB5R3 |