Antibodies

Jump to Filters
View as table Download
GSTM1 Rabbit Polyclonal Antibody
TA308892

USD 415.00

In Stock

Rabbit Polyclonal antibody to GSTM1 (glutathione S-transferase mu 1)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 189 of GSTM1
GSTM1 Rabbit Polyclonal Antibody
TA346205

USD 475.00

5 Days

Rabbit Polyclonal Anti-GSTM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTM1 antibody: synthetic peptide directed towards the N terminal of human GSTM1. Synthetic peptide located within the following region: KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI
GSTM1 Rabbit Polyclonal Antibody
TA346206

USD 475.00

5 Days

Rabbit Polyclonal Anti-GSTM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTM1 antibody: synthetic peptide directed towards the C terminal of human GSTM1. Synthetic peptide located within the following region: PEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGNK
GSTM1 Rabbit Polyclonal Antibody
TA324877

USD 450.00

5 Days

Rabbit polyclonal GSTM1 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GSTM1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 184-211 amino acids from the C-terminal region of human GSTM1.
GSTM1 Goat Polyclonal Antibody
TA302987

USD 375.00

5 Days

Goat Polyclonal Antibody against GSTM1 / GSTM2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CVFSKMAVWGNK, from the C Terminus of the protein sequence according to NP_000552; NP_666533; NP_000839.