Rabbit polyclonal anti-5-HT-2C antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human 5-HT-2C. |
Rabbit polyclonal anti-5-HT-2C antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human 5-HT-2C. |
Goat Polyclonal Antibody against HTR2C
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QVENLELPVN, from the internal region of the protein sequence according to NP_000859.1. |
Rabbit Polyclonal Anti-HTR2C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HTR2C antibody: synthetic peptide directed towards the N terminal of human HTR2C. Synthetic peptide located within the following region: SPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMA |
Rabbit Polyclonal Anti-HTR2C Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HTR2C |