Antibodies

View as table Download

Rabbit polyclonal antibody to PGAM1 (phosphoglycerate mutase 1 (brain))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 191 and 254 of PGAM1 (Uniprot ID#P18669)

Goat Polyclonal Antibody against PGAM1 / PGAM2 / PGAM4

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KAMEAVAAQGKAKK, from the C Terminus of the protein sequence according to NP_002620.1; NP_000281.2; NP_001025062.1.

Rabbit Polyclonal antibody to PGAM1 (phosphoglycerate mutase 1 (brain))

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 16 and 199 of PGAM1 (Uniprot ID#P18669)

Rabbit Polyclonal Anti-PGAM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGAM1 antibody is: synthetic peptide directed towards the C-terminal region of Human PGAM1. Synthetic peptide located within the following region: EEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGK