Antibodies

Jump to Filters
View as table Download
REST Rabbit Polyclonal Antibody
TA324112

USD 345.00

4 Weeks

Anti-REST Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.873~877(R-E-E-A-S) derived from Human REST.
REST Rabbit Polyclonal Antibody
TA330562

USD 375.00

5 Days

Rabbit Polyclonal Anti-REST Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-REST antibody: synthetic peptide directed towards the middle region of human REST. Synthetic peptide located within the following region: PMLPPSAVEEREAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLSD