Goat Anti-SOCS7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DAGRKPKLTRTQS, from the internal region of the protein sequence according to NP_055413.1. |
Goat Anti-SOCS7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DAGRKPKLTRTQS, from the internal region of the protein sequence according to NP_055413.1. |
Rabbit Polyclonal Anti-SOCS7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SOCS7 Antibody: synthetic peptide directed towards the N terminal of human SOCS7. Synthetic peptide located within the following region: LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP |
Rabbit Polyclonal Anti-SOCS7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SOCS7 Antibody is: synthetic peptide directed towards the N-terminal region of Human SOCS7. Synthetic peptide located within the following region: GSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTS |
Anti-SOCS7 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 6-20 amino acids of human suppressor of cytokine signaling 7 |
Anti-SOCS7 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 6-20 amino acids of human suppressor of cytokine signaling 7 |