Antibodies

View as table Download

Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-TKT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TKT antibody: synthetic peptide directed towards the N terminal of human TKT. Synthetic peptide located within the following region: ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL

Rabbit Polyclonal Anti-TKT Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TKT