Antibodies

View as table Download

C1QA goat polyclonal antibody, FITC

Applications ELISA, ID, IF, IHC, IP
Reactivities Human
Conjugation FITC
Immunogen The subunit C1q is isolated as a homogenous protein for use in antiserum production.
Freund’s complete adjuvant is used in the first step of the immunization.

Rabbit Polyclonal Anti-C1QA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1QA antibody: synthetic peptide directed towards the N terminal of human C1QA. Synthetic peptide located within the following region: PGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGG

C1QA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Human recombinant protein fragment of human C1QA ( NP_057075) produced in E.coli.

C1QA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Human recombinant protein fragment of human C1QA ( NP_057075) produced in E.coli.