Antibodies

Jump to Filters
View as table Download
DDX6 Goat Polyclonal Antibody
TA302462

USD 375.00

In Stock

Goat Polyclonal Antibody against DEAD-box protein 6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-AEYHSEPVEDEKP, from the C Terminus of the protein sequence according to NP_004388.1.
DDX6 Rabbit Polyclonal Antibody
TA341566

USD 375.00

5 Days

Rabbit Polyclonal Anti-DDX6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX6 antibody: synthetic peptide directed towards the N terminal of human DDX6. Synthetic peptide located within the following region: CLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYL
DDX6 Rabbit Polyclonal Antibody
TA341567

USD 310.00

5 Days

Rabbit Polyclonal Anti-DDX6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX6 antibody: synthetic peptide directed towards the N terminal of human DDX6. Synthetic peptide located within the following region: KTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ