Antibodies

View as table Download

Rabbit Polyclonal antibody to RPS3A (ribosomal protein S3A)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 14 and 264 of RPS3A (Uniprot ID#P61247)

Rabbit Polyclonal Anti-RPS3A Antibody

Applications WB
Reactivities Arabidopsis thaliana, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS3A Antibody: synthetic peptide directed towards the N terminal of human RPS3A. Synthetic peptide located within the following region: APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF