Antibodies

Jump to Filters
View as table Download
SLU7 Rabbit Polyclonal Antibody
TA315075

USD 345.00

4 Weeks

Rabbit polyclonal anti-SLU7 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized peptide derived from internal of human SLU7.
SLU7 Rabbit Polyclonal Antibody
TA340109

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLU7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLU7 antibody: synthetic peptide directed towards the N terminal of human SLU7. Synthetic peptide located within the following region: KKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKH