Antibodies

View as table Download

T1R1 / TAS1R1 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen T1R1 / TAS1R1 antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human TAS1R1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Marmoset (83%).

T1R1 / TAS1R1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig
Conjugation Unconjugated
Immunogen Synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human TAS1R1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Cat, Dog, Elephant, Panda, Horse, Pig (100%); Marmoset, Mouse, Rat, Hamster, Rabbit

Rabbit Polyclonal Anti-TAS1R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS1R1. Synthetic peptide located within the following region: NINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGT

Rabbit Polyclonal Anti-TAS1R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the middle region of Human TAS1R1. Synthetic peptide located within the following region: QKRAVPGLKAFEEAYARADKKAPRPCHKGSWCSSNQLCRECQAFMAHTMP