Antibodies

View as table Download

Rabbit Polyclonal Anti-VARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS antibody: synthetic peptide directed towards the middle region of human VARS. Synthetic peptide located within the following region: AQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML

Rabbit Polyclonal Anti-VARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VARS antibody: synthetic peptide directed towards the middle region of human VARS. Synthetic peptide located within the following region: VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP