Antibodies

Jump to Filters
View as table Download
G protein beta subunit like (MLST8) Rabbit Polyclonal Antibody
TA326904

USD 374.00

3 Weeks

MLST8 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MLST8
G protein beta subunit like (MLST8) Rabbit Polyclonal Antibody
TA344683

USD 475.00

5 Days

Rabbit Polyclonal Anti-GBL Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GBL antibody: synthetic peptide directed towards the middle region of human GBL. Synthetic peptide located within the following region: CAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVL
G protein beta subunit like (MLST8) Rabbit Polyclonal Antibody
TA306214

USD 430.00

5 Days

Rabbit Polyclonal GBL Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GbL antibody was raised against a 14 amino acid peptide from near the carboxy-terminus of human GbL.
G protein beta subunit like (MLST8) Rabbit Polyclonal Antibody
TA324118

USD 345.00

4 Weeks

Anti-MLST8 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein