Antibodies

View as table Download

Rabbit Polyclonal Anti-Cyclin G Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cyclin G Antibody: A synthesized peptide derived from human Cyclin G

Rabbit polyclonal anti-Cyclin G antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin G.

Rabbit Polyclonal Anti-CCNG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNG1 antibody: synthetic peptide directed towards the N terminal of human CCNG1. Synthetic peptide located within the following region: IEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARL

Rabbit anti Cyclin G1 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to C-terminal of human cyclin G1. This sequence is identical to human, mouse and rat.