Antibodies

View as table Download

Rabbit polyclonal anti-OR10G2 antibody

Applications IF, WB
Reactivities Human
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10G2.

Rabbit Polyclonal Anti-OR10G2 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-OR10G2 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10G2. Synthetic peptide located within the following region: PCIFIYLRAGSKDPLDGAAAVFYTVVTPLLNPLIYTLRNQEVKSALKRIT