Antibodies

View as table Download

Rabbit polyclonal anti-OR10J5 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10J5.

Rabbit polyclonal anti-OR6B2 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR6B2.

Rabbit Polyclonal Anti-OR10J5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10J5 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10J5. Synthetic peptide located within the following region: CIDTTINEIINYGVSSFVIFVPIGLIFISYVLVISSILQIASAEGRKKTF