Rabbit Polyclonal Anti-SGK196 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FLJ23356 antibody: synthetic peptide directed towards the N terminal of human FLJ23356. Synthetic peptide located within the following region: CEELRTEVRQLKRVGEGAVKRVFLSEWKEHKVALSQLTSLEMKDDFLHGL |
POMK rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human POMK |
POMK Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-350 of human POMK (NP_115613.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
