Germany
Japan
United Kingdom
China
Rabbit anti-SMARCA5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SMARCA5 |
Antibodies
View as table Download
Rabbit Polyclonal anti-SMARCA5 antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMARCA5 antibody: synthetic peptide directed towards the N terminal of human SMARCA5. Synthetic peptide located within the following region: AGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTE |
Rabbit Polyclonal Anti-SMARCA5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMARCA5 antibody: synthetic peptide directed towards the N terminal of human SMARCA5. Synthetic peptide located within the following region: SSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAVSA |
Rabbit polyclonal anti-SNF2H antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | SNF2H |
Rabbit Polyclonal Anti-SMARCA5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SMARCA5 |
SMARCA5 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human SNF2H |
SMARCA5 Rabbit monoclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SMARCA5
Isotypes
- IgG