Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TAC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAC1 antibody: synthetic peptide directed towards the middle region of human TAC1. Synthetic peptide located within the following region: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH |
Anti-TAC1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 58-68 amino acids of Human tachykinin, precursor 1 |
TAC1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-129 of human TAC1 (NP_003173.1). |
| Modifications | Unmodified |
Substance P Rabbit polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Substance P |
Active filters
Target Symbol
- TAC1
Isotypes
- IgG