Germany
Japan
United Kingdom
China
Rabbit Polyclonal FALDH Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Antibodies
View as table Download
Goat Polyclonal Anti-ALDH3A2 Antibody
| Applications | IHC |
| Reactivities | Human (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1. |
Rabbit Polyclonal Aldh3A2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Aldh3A2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Aldh3A2. |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the middle region of human ALDH3A2. Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ALDH3A2 |
ALDH3A2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ALDH3A2 |
ALDH3A2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 250-320 of human ALDH3A2 (NP_001026976.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ALDH3A2
Reactivities
- Human
Isotypes
- IgG
Filter by
Category
Antibody Hosts
Clonalities
Conjugates
Modifications
Families
Pathways
- Arginine and proline metabolism (6)
- Ascorbate and aldarate metabolism (6)
- Butanoate metabolism (6)
- Fatty acid metabolism (6)
- Glycerolipid metabolism (6)
- Glycolysis / Gluconeogenesis (6)
- Histidine metabolism (6)
- Limonene and pinene degradation (6)
- Lysine degradation (6)
- Metabolic pathways (6)
- Propanoate metabolism (6)
- Pyruvate metabolism (6)
- Tryptophan metabolism (6)
- Valine (6)
- beta-Alanine metabolism (6)
- leucine and isoleucine degradation (6)