Antibodies

View as table Download

Rabbit Polyclonal Anti-ARNT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ARNT2 antibody is: synthetic peptide directed towards the N-terminal region of Human ARNT2. Synthetic peptide located within the following region: VTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHS

Rabbit polyclonal ARNT2 Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ARNT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 249-278 amino acids from the Central region of human ARNT2.

Rabbit polyclonal anti-ARNT2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARNT2.

ARNT2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 440-690 of human ARNT2 (NP_055677.3).
Modifications Unmodified