Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-BTBD6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BTBD6 antibody: synthetic peptide directed towards the N terminal of human BTBD6. Synthetic peptide located within the following region: FVVGPPGATRTVPAHKYVLAVGSSVFYAMFYGDLAEVKSEIHIPDVEPAA |
Rabbit Polyclonal Anti-BTBD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BTBD6 antibody: synthetic peptide directed towards the middle region of human BTBD6. Synthetic peptide located within the following region: GKAFNRCSHLTRHKKIHTAVKRYKCEECGKAFKRCSHLNEHKRVQRGEKS |
Rabbit polyclonal anti-BTBD6 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from interf human BTBD6. |
Rabbit Polyclonal Anti-BTBD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BTBD6 antibody: synthetic peptide directed towards the middle region of human BTBD6. Synthetic peptide located within the following region: ALRSEGFCEIDRQTLEIIVTREALNTKEAVVFEAVLNWAEAECKRQGLPI |
Active filters
Target Symbol
- BTBD6
Reactivities
- Human
Isotypes
- IgG