Antibodies

View as table Download

Rabbit Polyclonal KAI1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KAI1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human KAI1.

Rabbit anti-CD82 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CD82

Rabbit Polyclonal Anti-CD82 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD82 antibody is: synthetic peptide directed towards the middle region of CD82. Synthetic peptide located within the following region: ELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTY