Antibodies

Jump to Filters
View as table Download
Alpha Dystroglycan (DAG1) Rabbit Polyclonal Antibody
TA339411

USD 375.00

5 Days

Rabbit Polyclonal Anti-DAG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DAG1 antibody: synthetic peptide directed towards the middle region of human DAG1. Synthetic peptide located within the following region: AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT
Alpha Dystroglycan (DAG1) Rabbit Polyclonal Antibody
TA375317

USD 220.00

3 Weeks

DAG1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 654-749 of human DAG1 (NP_004384.4).
Modifications Unmodified