Rabbit Polyclonal Anti-DCP1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCP1B antibody: synthetic peptide directed towards the N terminal of human DCP1B. Synthetic peptide located within the following region: TLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQQQQQQQEKLPIR |
DCP1B rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DCP1B |
DCP1B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DCP1B. |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
