Antibodies

View as table Download

Rabbit Polyclonal Anti-ESRRG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ESRRG antibody: synthetic peptide directed towards the N terminal of human ESRRG. Synthetic peptide located within the following region: DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN

Goat Polyclonal Antibody against ESRRG

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CRMSNKDRHIDS, from the internal region of the protein sequence according to NP_001429.2; NP_996317.1; NP_996318.1.

Rabbit polyclonal ESRRG Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ESRRG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 189-221 amino acids from the Central region of human ESRRG.

Rabbit Polyclonal Anti-ESRRG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ESRRG antibody: synthetic peptide directed towards the N terminal of human ESRRG. Synthetic peptide located within the following region: TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML

Rabbit Polyclonal Anti-ESRRG Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ESRRG

ESRRG Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ESRRG (NP_001429.2).
Modifications Unmodified