Antibodies

Jump to Filters
View as table Download
FBXL3 Rabbit Polyclonal Antibody
TA308248

USD 415.00

5 Days

Rabbit polyclonal antibody to FBXL3 (F-box and leucine-rich repeat protein 3)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 14 and 309 of FBXL3 (Uniprot ID#Q9UKT7)
FBXL3 Goat Polyclonal Antibody
TA303140

USD 375.00

5 Days

Goat Polyclonal Antibody against FBXL3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KRGGRDSDRNSSEE-C, from the N Terminus of the protein sequence according to NP_036290.1.
FBXL3 Rabbit Polyclonal Antibody
TA329814

USD 375.00

5 Days

Rabbit Polyclonal Anti-FBXL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXL3 antibody: synthetic peptide directed towards the middle region of human FBXL3. Synthetic peptide located within the following region: LISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLV