Antibodies

View as table Download

GPC4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPC4

GPC4 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Dog, Gorilla, Hamster, Human, Pig
Conjugation Unconjugated
Immunogen GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Hamster, Panda, Dog, Pig (100%); Marmoset, Mouse, Elephant, Bovine, Horse (94%); Rat, Bat, Rabbit (88%).

GPC4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Gorilla, Hamster, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from internal region of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Bat, Hamster (100%); Marmoset, Dog, Elephant, Panda, Rabbit (94%); Bovine, Horse, Pig (88%).

GPC4 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset, Rabbit (94%); Mouse, Rat, Bovine, Panda (88%); Hamster, Horse (81%).

Rabbit Polyclonal Anti-GPC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPC4 antibody is: synthetic peptide directed towards the C-terminal region of Human GPC4. Synthetic peptide located within the following region: EYQQCPSEFDYNATDHAGKSANEKADSAGVRPGAQAYLLTVFCILFLVMQ

GPC4 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPC4

GPC4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 357-556 of human GPC4 (NP_001439.2).
Modifications Unmodified