Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-HK1 (HXK1) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HXK1. |
Rabbit Polyclonal Anti-Hexokinase 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Hexokinase 1 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human Hexokinase 1. |
Rabbit Polyclonal Anti-HK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HK1 antibody: synthetic peptide directed towards the middle region of human HK1. Synthetic peptide located within the following region: ILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR |
Rabbit Polyclonal Anti-HK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HK1 antibody: synthetic peptide directed towards the N terminal of human HK1. Synthetic peptide located within the following region: CQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVV |
Rabbit Polyclonal Anti-HK1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HK1 |
HK1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HK1 |
Active filters
Target Symbol
- HK1
Reactivities
- Human
Isotypes
- IgG