Antibodies

View as table Download

Rabbit polyclonal Anti-HLA-DQA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the N terminal of human HLA-DQA2. Synthetic peptide located within the following region: GVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQS

Rabbit polyclonal Anti-HLA-DQA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the middle region of human HLA-DQA2. Synthetic peptide located within the following region: LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK

HLA-DQA2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HLA-DQA2