Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-POU4F3 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human POU4F3. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-POU4F3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-POU4F3 Antibody: synthetic peptide directed towards the middle region of human POU4F3. Synthetic peptide located within the following region: ALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYR |
POU4F3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human POU4F3 (NP_002691.1). |
| Modifications | Unmodified |
POU4F3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human POU4F3 (NP_002691.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- POU4F3
Reactivities
- Human
Isotypes
- IgG