Antibodies

View as table Download

Rabbit Polyclonal Anti-PPP2R5D Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5D antibody: synthetic peptide directed towards the middle region of human PPP2R5D. Synthetic peptide located within the following region: ETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEA

Goat Polyclonal Antibody against PPP2R5D

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KRAEEFLTASQEAL, from the C Terminus of the protein sequence according to NP_006236.

Rabbit polyclonal anti-PPP2R5D antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPP2R5D.

PP2A-B56δ/PR61δ/PPP2R5D Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-550 of human PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D (NP_006236.1).
Modifications Unmodified