Antibodies

Jump to Filters
View as table Download
PRDM9 Rabbit Polyclonal Antibody
TA339515

USD 375.00

5 Days

Rabbit Polyclonal Anti-PRDM9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDM9 antibody: synthetic peptide directed towards the middle region of human PRDM9. Synthetic peptide located within the following region: CPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP
PRDM9 Rabbit Polyclonal Antibody
TA380303

USD 220.00

3 Weeks

PRDM9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRDM9.
Modifications Unmodified