Antibodies

View as table Download

Rabbit polyclonal PRELP Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PRELP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 257-286 amino acids from the C-terminal region of human PRELP.

Rabbit Polyclonal Anti-PRELP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRELP antibody: synthetic peptide directed towards the middle region of human PRELP. Synthetic peptide located within the following region: SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH

Rabbit polyclonal PRELP Antibody (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PRELP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 119-148 amino acids from the Central region of human PRELP.

PRELP rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PRELP

PRELP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PRELP