Antibodies

View as table Download

Goat Polyclonal Antibody against TMPRSS5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-LDWIHDTAQDSLL, from the C Terminus of the protein sequence according to NP_110397.1.

Rabbit Polyclonal Anti-TMPRSS5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMPRSS5 antibody: synthetic peptide directed towards the middle region of human TMPRSS5. Synthetic peptide located within the following region: SWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALN

Rabbit Polyclonal Anti-TMPRSS5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TMPRSS5

TMPRSS5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TMPRSS5