Goat Polyclonal Antibody against TMPRSS5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-LDWIHDTAQDSLL, from the C Terminus of the protein sequence according to NP_110397.1. |
Goat Polyclonal Antibody against TMPRSS5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-LDWIHDTAQDSLL, from the C Terminus of the protein sequence according to NP_110397.1. |
Rabbit Polyclonal Anti-TMPRSS5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TMPRSS5 antibody: synthetic peptide directed towards the middle region of human TMPRSS5. Synthetic peptide located within the following region: SWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALN |
Rabbit Polyclonal Anti-TMPRSS5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TMPRSS5 |
TMPRSS5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TMPRSS5 |