Rabbit Polyclonal Anti-ZHX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZHX2 antibody: synthetic peptide directed towards the N terminal of human ZHX2. Synthetic peptide located within the following region: MASKRKSTTPCMVRTSQVVEQDVPEEVDRAKEKGIGTPQPDVAKDSWAAE |
Rabbit polyclonal ZHX2 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ZHX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 105-131 amino acids from the N-terminal region of human ZHX2. |
Rabbit polyclonal anti-ZHX2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZHX2. |
ZHX2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ZHX2. |
Germany
Japan
United Kingdom
China
