Antibodies

Jump to Filters
View as table Download
CIITA Rabbit Polyclonal Antibody
TA372239

USD 380.00

4 Weeks

CIITA rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CIITA
CIITA Rabbit Polyclonal Antibody
TA314195

USD 345.00

In Stock

Rabbit polyclonal anti-CIITA antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CIITA.
CIITA Rabbit Polyclonal Antibody
TA319682

USD 430.00

5 Days

Rabbit Polyclonal CIITA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CIITA antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human CIITA.
Ciita Rabbit Polyclonal Antibody
TA341750

USD 375.00

5 Days

Rabbit Polyclonal Anti-Ciita Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-C2TA antibody: synthetic peptide directed towards the C terminal of mouse C2TA. Synthetic peptide located within the following region: MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN