Antibodies

View as table Download

Rabbit polyclonal anti-HOXC6 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HOXC6.

Rabbit polyclonal HOXC6 Antibody (C-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HOXC6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-227 amino acids from the C-terminal region of human HOXC6.

Rabbit Polyclonal Anti-HOXC6 Antibody

Applications IHC
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXC6 antibody: synthetic peptide directed towards the C terminal of human HOXC6. Synthetic peptide located within the following region: KIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE

Rabbit Polyclonal Anti-HOXC6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXC6