Antibodies

Jump to Filters
View as table Download
MAX Goat Polyclonal Antibody
TA302711

USD 375.00

5 Days

Goat Polyclonal Antibody against MAX

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-EEPQSRKKLRMEAS, from the C Terminus of the protein sequence according to NP_002373.
MAX Rabbit Polyclonal Antibody
TA324270

USD 345.00

4 Weeks

Anti-MAX Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
MAX Rabbit Polyclonal Antibody
TA335837

USD 310.00

5 Days

Rabbit Polyclonal Anti-MAX Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAX Antibody: synthetic peptide directed towards the middle region of human MAX. Synthetic peptide located within the following region: LQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
MAX Rabbit Polyclonal Antibody
TA378364

USD 220.00

3 Weeks

MAX Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-1-160 of human MAX (NP_002373.3).
Modifications Unmodified