Antibodies

View as table Download

Rabbit polyclonal anti-MSX2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human MSX2.

Rabbit Polyclonal anti-MSX2 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MSX2 antibody: synthetic peptide directed towards the n terminal of human MSX2. Synthetic peptide located within the following region: MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVE

MSX2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-267 of human MSX2 (NP_002440.2).
Modifications Unmodified