Antibodies

Jump to Filters
View as table Download
SEC23B Rabbit Polyclonal Antibody
TA340104

USD 375.00

5 Days

Rabbit Polyclonal Anti-SEC23B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SEC23B antibody: synthetic peptide directed towards the middle region of human SEC23B. Synthetic peptide located within the following region: SFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPI
SEC23B Rabbit Polyclonal Antibody
TA381327

USD 220.00

3 Weeks

Sec23B Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Sec23B (NP_006354.2).
Modifications Unmodified