Antibodies

View as table Download

Goat Anti-Slc10a2 (mouse) Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-DETNKGFQPDEK, from the C Terminus of the protein sequence according to NP_035518.1.

Rabbit Polyclonal Anti-Slc10a2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Slc10a2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVV

SLC10A2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 289-348 of human SLC10A2 (NP_000443.1).
Modifications Unmodified