Antibodies

Jump to Filters
View as table Download
ALDH4A1 Rabbit Polyclonal Antibody
TA337809

USD 375.00

5 Days

Rabbit Polyclonal Anti-Aldh4a1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Aldh4a1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GSGLRWKHASSLKVANEPILAFTQGSPERDALQKALNDLKDQTEAIPCVV
ALDH4A1 Rabbit Polyclonal Antibody
TA323995

USD 345.00

In Stock

Anti-ALDH4A1 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 4 family, member A1
ALDH4A1 Rabbit Polyclonal Antibody
TA323996

USD 345.00

In Stock

Anti-ALDH4A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 4 family, member A1