Antibodies

Jump to Filters
View as table Download
Cpne7 Rabbit Polyclonal Antibody
TA334535

USD 375.00

5 Days

Rabbit Polyclonal Anti-Cpne7 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cpne7 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GDDGILRSPRGEPALRDIVQFVPFRELKNASPAALAKCVLAEVPKQVVEY
CPNE7 Rabbit Polyclonal Antibody
TA365695

USD 380.00

4 Weeks

CPNE7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CPNE7
CPNE7 Rabbit Polyclonal Antibody
TA370034

USD 380.00

4 Weeks

CPNE7 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CPNE7