Antibodies

Jump to Filters
View as table Download
Dnd1 Rabbit Polyclonal Antibody
TA344036

USD 475.00

5 Days

Rabbit Polyclonal Anti-Dnd1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Dnd1 antibody is: synthetic peptide directed towards the middle region of Rat Dnd1. Synthetic peptide located within the following region: KYGGPPPGWVGSPPPSGSEVFIGRLPQDVYEHQLIPLFQRVGRLYEFRLM
DND1 Rabbit Polyclonal Antibody
TA375548

USD 220.00

3 Weeks

DND1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DND1.